| Name | SFPQ antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1373 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SFPQ Blocking Peptide |
| Description | Rabbit polyclonal SFPQ antibody |
| Gene | SFPQ |
| Supplier Page | Shop |