RSF1 antibody

Name RSF1 antibody
Supplier Fitzgerald
Catalog 70R-2111
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
Purity/Format Affinity purified
Blocking Peptide RSF1 Blocking Peptide
Description Rabbit polyclonal RSF1 antibody raised against the middle region of RSF1
Gene RSF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.