| Name | PIP3-E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1020 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PIP3-E Blocking Peptide |
| Description | Rabbit polyclonal PIP3-E antibody raised against the C terminal of PIP3-E |
| Gene | IPCEF1 |
| Supplier Page | Shop |