| Name | CORIN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1759 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CORIN Blocking Peptide |
| Description | Rabbit polyclonal CORIN antibody raised against the C terminal of CORIN |
| Gene | CRNKL1 |
| Supplier Page | Shop |