Name | KIF2B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5604 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK |
Purity/Format | Affinity purified |
Blocking Peptide | KIF2B Blocking Peptide |
Description | Rabbit polyclonal KIF2B antibody raised against the middle region of KIF2B |
Gene | KIF2B |
Supplier Page | Shop |