KIF2B antibody

Name KIF2B antibody
Supplier Fitzgerald
Catalog 70R-5604
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK
Purity/Format Affinity purified
Blocking Peptide KIF2B Blocking Peptide
Description Rabbit polyclonal KIF2B antibody raised against the middle region of KIF2B
Gene KIF2B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.