| Name | TEX14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2688 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN |
| Purity/Format | Affinity purified |
| Blocking Peptide | TEX14 Blocking Peptide |
| Description | Rabbit polyclonal TEX14 antibody raised against the C terminal of TEX14 |
| Gene | TEX14 |
| Supplier Page | Shop |