| Name | MUC3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7090 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MUC3B antibody was raised using the middle region of MUC3B corresponding to a region with amino acids KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA |
| Purity/Format | Affinity purified |
| Blocking Peptide | MUC3B Blocking Peptide |
| Description | Rabbit polyclonal MUC3B antibody raised against the middle region of MUC3B |
| Gene | MUC3A |
| Supplier Page | Shop |