| Name | MPPED2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5251 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT |
| Purity/Format | Affinity purified |
| Blocking Peptide | MPPED2 Blocking Peptide |
| Description | Rabbit polyclonal MPPED2 antibody raised against the N terminal of MPPED2 |
| Gene | MPPED2 |
| Supplier Page | Shop |