MUC15 antibody

Name MUC15 antibody
Supplier Fitzgerald
Catalog 70R-6736
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
Purity/Format Affinity purified
Blocking Peptide MUC15 Blocking Peptide
Description Rabbit polyclonal MUC15 antibody raised against the middle region of MUC15
Gene MUC15
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.