EIF4A1 antibody

Name EIF4A1 antibody
Supplier Fitzgerald
Catalog 70R-4514
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen EIF4A1 antibody was raised using the middle region of EIF4A1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
Purity/Format Affinity purified
Blocking Peptide EIF4A1 Blocking Peptide
Description Rabbit polyclonal EIF4A1 antibody raised against the middle region of EIF4A1
Gene EIF4A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.