| Name | POLR2H antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1052 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | POLR2H antibody was raised using the N terminal of POLR2H corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | POLR2H Blocking Peptide |
| Description | Rabbit polyclonal POLR2H antibody raised against the N terminal of POLR2H |
| Gene | POLR2H |
| Supplier Page | Shop |