| Name | MS4A4A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6928 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MS4A4A Blocking Peptide |
| Description | Rabbit polyclonal MS4A4A antibody raised against the N terminal of MS4A4A |
| Gene | MS4A4A |
| Supplier Page | Shop |