| Name | AMDHD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4162 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | AMDHD1 Blocking Peptide |
| Description | Rabbit polyclonal AMDHD1 antibody raised against the N terminal of AMDHD1 |
| Gene | AMDHD1 |
| Supplier Page | Shop |