| Name | Claudin 8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1695 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Claudin 8 Blocking Peptide |
| Description | Rabbit polyclonal Claudin 8 antibody raised against the C terminal of CLDN8 |
| Gene | CLDN8 |
| Supplier Page | Shop |