Name | WDR21A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1983 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT |
Purity/Format | Affinity purified |
Blocking Peptide | WDR21A Blocking Peptide |
Description | Rabbit polyclonal WDR21A antibody raised against the middle region of WDR21A |
Gene | DCAF4 |
Supplier Page | Shop |