| Name | CENPP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2175 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | CENPP Blocking Peptide |
| Description | Rabbit polyclonal CENPP antibody raised against the N terminal of CENPP |
| Gene | CENPP |
| Supplier Page | Shop |