Name | AMH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6224 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Purity/Format | Affinity purified |
Blocking Peptide | AMH Blocking Peptide |
Description | Rabbit polyclonal AMH antibody raised against the middle region of AMH |
Gene | S100A8 |
Supplier Page | Shop |