| Name | ACP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1276 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ACP1 Blocking Peptide |
| Description | Rabbit polyclonal ACP1 antibody raised against the N terminal of ACP1 |
| Gene | ACP1 |
| Supplier Page | Shop |