ZCCHC12 antibody

Name ZCCHC12 antibody
Supplier Fitzgerald
Catalog 70R-2560
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZCCHC12 antibody was raised using the N terminal of ZCCHC12 corresponding to a region with amino acids AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE
Purity/Format Affinity purified
Blocking Peptide ZCCHC12 Blocking Peptide
Description Rabbit polyclonal ZCCHC12 antibody raised against the N terminal of ZCCHC12
Gene ZCCHC12
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.