BRUNOL5 antibody

Name BRUNOL5 antibody
Supplier Fitzgerald
Catalog 70R-4930
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT
Purity/Format Affinity purified
Blocking Peptide BRUNOL5 Blocking Peptide
Description Rabbit polyclonal BRUNOL5 antibody raised against the middle region of BRUNOL5
Gene CELF5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.