| Name | CCDC74A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4386 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CCDC74A antibody was raised using the middle region of CCDC74A corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | CCDC74A Blocking Peptide |
| Description | Rabbit polyclonal CCDC74A antibody raised against the middle region of CCDC74A |
| Gene | CCDC74A |
| Supplier Page | Shop |