Name | NOVA2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1469 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Zebrafish |
Antigen | NOVA2 antibody was raised using the N terminal of NOVA2 corresponding to a region with amino acids MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | NOVA2 Blocking Peptide |
Description | Rabbit polyclonal NOVA2 antibody raised against the N terminal of NOVA2 |
Gene | NOVA2 |
Supplier Page | Shop |