| Name | DDT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2944 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS |
| Purity/Format | Affinity purified |
| Blocking Peptide | DDT Blocking Peptide |
| Description | Rabbit polyclonal DDT antibody raised against the N terminal of DDT |
| Gene | DDT |
| Supplier Page | Shop |