| Name | RAB18 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5796 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB18 Blocking Peptide |
| Description | Rabbit polyclonal RAB18 antibody raised against the C terminal of RAB18 |
| Gene | RAB18 |
| Supplier Page | Shop |