| Name | HLA-F antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6448 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
| Purity/Format | Affinity purified |
| Blocking Peptide | HLA-F Blocking Peptide |
| Description | Rabbit polyclonal HLA-F antibody raised against the N terminal of HLA-F |
| Gene | ACTR6 |
| Supplier Page | Shop |