Name | Bradykinin Receptor B2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1662 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | Bradykinin Receptor B2 Blocking Peptide |
Description | Rabbit polyclonal Bradykinin Receptor B2 antibody raised against the N terminal of BDKRB2 |
Gene | BDKRB2 |
Supplier Page | Shop |