Name | EARS2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3329 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL |
Purity/Format | Affinity purified |
Blocking Peptide | EARS2 Blocking Peptide |
Description | Rabbit polyclonal EARS2 antibody |
Gene | EARS2 |
Supplier Page | Shop |