| Name | C1ORF151 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6832 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C1ORF151 antibody was raised using the middle region of C1Orf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1ORF151 Blocking Peptide |
| Description | Rabbit polyclonal C1ORF151 antibody raised against the middle region of C1Orf151 |
| Gene | MINOS1 |
| Supplier Page | Shop |