PPM1J antibody

Name PPM1J antibody
Supplier Fitzgerald
Catalog 70R-3522
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen PPM1J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE
Purity/Format Affinity purified
Blocking Peptide PPM1J Blocking Peptide
Description Rabbit polyclonal PPM1J antibody
Gene PPM1J
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.