TRIML2 antibody

Name TRIML2 antibody
Supplier Fitzgerald
Catalog 70R-4258
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVS
Purity/Format Affinity purified
Blocking Peptide TRIML2 Blocking Peptide
Description Rabbit polyclonal TRIML2 antibody raised against the middle region of TRIML2
Gene TRIML2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.