| Name | RRP9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1341 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RRP9 antibody was raised using the middle region of RRP9 corresponding to a region with amino acids IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RRP9 Blocking Peptide |
| Description | Rabbit polyclonal RRP9 antibody raised against the middle region of RRP9 |
| Gene | RRP9 |
| Supplier Page | Shop |