| Name | PPAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2079 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPAT Blocking Peptide |
| Description | Rabbit polyclonal PPAT antibody raised against the N terminal of PPAT |
| Gene | PPAT |
| Supplier Page | Shop |