| Name | PGM3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4450 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PGM3 Blocking Peptide |
| Description | Rabbit polyclonal PGM3 antibody raised against the N terminal of PGM3 |
| Gene | PGM3 |
| Supplier Page | Shop |