| Name | LRRC52 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6320 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LRRC52 antibody was raised using the N terminal of LRRC52 corresponding to a region with amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC52 Blocking Peptide |
| Description | Rabbit polyclonal LRRC52 antibody raised against the N terminal of LRRC52 |
| Gene | LRRC52 |
| Supplier Page | Shop |