ANKMY2 antibody

Name ANKMY2 antibody
Supplier Fitzgerald
Catalog 70R-3554
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL
Purity/Format Affinity purified
Blocking Peptide ANKMY2 Blocking Peptide
Description Rabbit polyclonal ANKMY2 antibody raised against the N terminal of ANKMY2
Gene ANKMY2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.