| Name | FAM13C1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3463 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM13C1 Blocking Peptide |
| Description | Rabbit polyclonal FAM13C1 antibody raised against the N terminal of FAM13C1 |
| Gene | FAM13C |
| Supplier Page | Shop |