| Name | RAB39B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5833 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB39B Blocking Peptide |
| Description | Rabbit polyclonal RAB39B antibody raised against the N terminal of RAB39B |
| Gene | RAB39B |
| Supplier Page | Shop |