| Name | SHMT2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3206 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | SHMT2 Blocking Peptide |
| Description | Rabbit polyclonal SHMT2 antibody |
| Gene | SHMT2 |
| Supplier Page | Shop |