Cystatin S antibody

Name Cystatin S antibody
Supplier Fitzgerald
Catalog 70R-1571
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Cystatin S antibody was raised using the N terminal of CST4 corresponding to a region with amino acids MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF
Purity/Format Total IgG Protein A purified
Blocking Peptide Cystatin S Blocking Peptide
Description Rabbit polyclonal Cystatin S antibody raised against the N terminal of CST4
Gene CST4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.