| Name | SNRK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2565 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN |
| Purity/Format | Affinity purified |
| Blocking Peptide | SNRK Blocking Peptide |
| Description | Rabbit polyclonal SNRK antibody raised against the middle region of SNRK |
| Gene | SNRK |
| Supplier Page | Shop |