Name | B3GNT4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2853 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | B3GNT4 antibody was raised using the N terminal of B3GNT4 corresponding to a region with amino acids MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR |
Purity/Format | Affinity purified |
Blocking Peptide | B3GNT4 Blocking Peptide |
Description | Rabbit polyclonal B3GNT4 antibody raised against the N terminal of B3GNT4 |
Gene | B3GNT4 |
Supplier Page | Shop |