Name | SLC26A8 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1764 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | SLC26A8 antibody was raised using the C terminal of SLC26A8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | SLC26A8 Blocking Peptide |
Description | Rabbit polyclonal SLC26A8 antibody raised against the C terminal of SLC26A8 |
Gene | SLC26A8 |
Supplier Page | Shop |