SRP19 antibody

Name SRP19 antibody
Supplier Fitzgerald
Catalog 70R-1410
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
Purity/Format Total IgG Protein A purified
Blocking Peptide SRP19 Blocking Peptide
Description Rabbit polyclonal SRP19 antibody raised against the middle region of SRP19
Gene SRP19
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.