ALDH1B1 antibody

Name ALDH1B1 antibody
Supplier Fitzgerald
Catalog 70R-3238
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL
Purity/Format Affinity purified
Blocking Peptide ALDH1B1 Blocking Peptide
Description Rabbit polyclonal ALDH1B1 antibody raised against the middle region of ALDH1B1
Gene ALDH1B1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.