| Name | RPIA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4423 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPIA Blocking Peptide |
| Description | Rabbit polyclonal RPIA antibody |
| Gene | RPIA |
| Supplier Page | Shop |