| Name | DGKE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5996 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
| Purity/Format | Affinity purified |
| Blocking Peptide | DGKE Blocking Peptide |
| Description | Rabbit polyclonal DGKE antibody raised against the N terminal of DGKE |
| Gene | DGKB |
| Supplier Page | Shop |