| Name | FKBPL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3815 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL |
| Purity/Format | Affinity purified |
| Blocking Peptide | FKBPL Blocking Peptide |
| Description | Rabbit polyclonal FKBPL antibody raised against the N terminal of FKBPL |
| Gene | FKBPL |
| Supplier Page | Shop |