| Name | Cortactin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2725 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cortactin Blocking Peptide |
| Description | Rabbit polyclonal Cortactin antibody raised against the N terminal of CTTN |
| Gene | CTTN |
| Supplier Page | Shop |