Name | WNT5B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5289 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
Purity/Format | Affinity purified |
Blocking Peptide | WNT5B Blocking Peptide |
Description | Rabbit polyclonal WNT5B antibody raised against the middle region of WNT5B |
Gene | WNT5B |
Supplier Page | Shop |